PeptideDB

Noxiustoxin

CAS: 85205-49-8 F: C174H286N52O54S7 W: 4195.00

Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassiu
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease[1][2].
Name Noxiustoxin
CAS 85205-49-8
Sequence Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Ser-Lys-Pro-Cys-Lys-Glu-Leu-Tyr-Gly-Ser-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Asn-Asn-NH2 (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
Shortening TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2 (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
Formula C174H286N52O54S7
Molar Mass 4195.00
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. M Dauplais, et al. Determination of the Three-Dimensional Solution Structure of Noxiustoxin: Analysis of Structural Differences with Related Short-Chain Scorpion Toxins. Biochemistry.1995 Dec 26;34(51):16563-73. [2]. H H Valdivia, et al. Charybdotoxin and noxiustoxin, two homologous peptide inhibitors of the K+(Ca2+) channel. FEBS Lett. 1988 Jan 4;226(2):280-4.