PeptideDB

Neuropeptide Y (human) (TFA)

CAS: F: C191H286F3N55O59S W: 4385.70

Neuropeptide Y (human) TFA is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Neuropeptide Y (human) TFA is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.
Invitro It is showed that Neuropeptide Y (human) is able to protect cortical neurons from Aβ25-35 toxicity. 2 μM NPY abolishes the toxic effects of Aβ25-35 at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (human) pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human (TFA) Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ35-25[1].
Name Neuropeptide Y (human) (TFA)
Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Formula C191H286F3N55O59S
Molar Mass 4385.70
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)