| Bioactivity | MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH100-fold) proton-evoked activation of ASIC2a channels[1]. |
| Name | MitTx-alpha |
| Sequence | {Pyr}-Ile-Arg-Pro-Ala-Phe-Cys-Tyr-Glu-Asp-Pro-Pro-Phe-Phe-Gln-Lys-Cys-Gly-Ala-Phe-Val-Asp-Ser-Tyr-Tyr-Phe-Asn-Arg-Ser-Arg-Ile-Thr-Cys-Val-His-Phe-Phe-Tyr-Gly-Gln-Cys-Asp-Val-Asn-Gln-Asn-His-Phe-Thr-Thr-Met-Ser-Glu-Cys-Asn-Arg-Val-Cys-His-Gly (Disulfide bridge: Cys7-Cys54; Cys17-Cys41; Cys33-Cys58) |
| Shortening | {Pyr}-IRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG (Disulfide bridge: Cys7-Cys54; Cys17-Cys41; Cys33-Cys58) |
| Formula | C317H440N86O89S7 |
| Molar Mass | 7103.94 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Christopher J Bohlen, et al. A heteromeric Texas coral snake toxin targets acid-sensing ion channels to produce pain. Nature. 2011 Nov 16;479(7373):410-4. |