| Bioactivity | LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies. | ||||||
| Name | LL-37 scrambled peptide acetate | ||||||
| Sequence | Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg | ||||||
| Shortening | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR | ||||||
| Formula | C205H340N60O53.C2H4O2 | ||||||
| Molar Mass | 4553.35 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Gerard Sheehan, et al. The Human Cathelicidin Antimicrobial Peptide LL-37 Promotes the Growth of the Pulmonary Pathogen Aspergillus fumigatus. Infect Immun. 2018 Jun 21;86(7):e00097-18. |
LL-37 scrambled peptide acetate
CAS: F: C205H340N60O53.C2H4O2 W: 4553.35
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled pep
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.