PeptideDB

LL-37 scrambled peptide acetate

CAS: F: C205H340N60O53.C2H4O2 W: 4553.35

LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled pep
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
Name LL-37 scrambled peptide acetate
Sequence Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg
Shortening GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Formula C205H340N60O53.C2H4O2
Molar Mass 4553.35
Appearance Solid
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Reference [1]. Gerard Sheehan, et al. The Human Cathelicidin Antimicrobial Peptide LL-37 Promotes the Growth of the Pulmonary Pathogen Aspergillus fumigatus. Infect Immun. 2018 Jun 21;86(7):e00097-18.