| Bioactivity | KP-6, a polypeptide, is a Wnt/β-catenin signal inhibitor. KP-6 inhibits TGF-β and blocks rush fibrosis signal path crucial in vivo. KP-6 suppresses Renal tissues damage and renal fibrosis, and reverse the course of disease of chronic kidney disease (CKD)[1]. |
| CAS | 2102414-23-1 |
| Sequence | Gln-Pro-Val-Val-Thr-Leu-Tyr-His-Trp-Asp-Leu-Pro-Gln-Arg-Leu-Gln-Asp-Ala-Tyr-Gly-Gly-Trp-Ala-Asn-Arg-Ala-Leu-Ala-Asp-His |
| Shortening | QPVVTLYHWDLPQRLQDAYGGWANRALADH |
| Formula | C159H232N46O44 |
| Molar Mass | 3491.83 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Youhua Liu, et al. Purposes of the micromolecule polypeptide KP 6 in the medicine for preparing treatment CKD. CN106822865A. |