PeptideDB

Jingzhaotoxin-34

CAS: F: C154H219N39O45S7 W: 3561.08

Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) so
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons[1].
Name Jingzhaotoxin-34
Sequence Gly-Cys-Gly-Thr-Met-Trp-Ser-Pro-Cys-Ser-Thr-Glu-Lys-Pro-Cys-Cys-Asp-Asn-Phe-Ser-Cys-Gln-Pro-Ala-Ile-Lys-Trp-Cys-Ile-Trp-Ser-Pro (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29)
Shortening ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29)
Formula C154H219N39O45S7
Molar Mass 3561.08
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Jinjun Chen, et al. Expression and characterization of jingzhaotoxin-34, a novel neurotoxin from the venom of the tarantula Chilobrachys jingzhao. Peptides. 2009 Jun;30(6):1042-8.