| Bioactivity | Iberiotoxin (TFA) is a selective high conductance high conductance Ca2+-activated K+ channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels[1][2][3]. |
| Target | Kd: 1 nM (Ca2+-activated K+ channel) |
| Name | Iberiotoxin TFA |
| Sequence | {Glp}-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35) |
| Shortening | {Glp}-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35) |
| Formula | C179H274N50O55S7.xC2HF3O2 |
| Molar Mass | 4230.85 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Galvez A, et al. Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus. J Biol Chem. 1990;265(19):11083-11090. [2]. Echeverry S, et al. Activation of BK Channel Contributes to PL-Induced Mesenchymal Stem Cell Migration. Front Physiol. 2020;11:210. [3]. Wang RJ, et al. Downregulation of large conductance calcium-activated potassium channels in paraventricular nucleus contributes to sympathoexcitation in rats with chronic heart failure. Zhonghua Xin Xue Guan Bing Za Zhi. 2018;46(3):178-186. |
Iberiotoxin TFA
CAS: F: C179H274N50O55S7.xC2HF3O2 W: 4230.85 (free base)
Iberiotoxin (TFA) is a selective high conductance high conductance Ca2+-activated K+ channel inhibitor with a Kd of ~1 n
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.