| Bioactivity | Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary[1]. | ||||||
| Invitro | The GHRHR is a member of the class II B GPCR family, which couples predominantly to the Gs-adenylate cyclase-cAMP signaling pathway. Peptide hormones that activate class II GPCRs include GHRH, secretin, glucagon-like peptides, gastric-inhibitory peptide (GIP), pituitary adenylate cyclase-activating peptide, corticotropin-releasing hormone, vasoactive intestinal peptide, parathyroid hormone, and calcitonin-related peptides[1].GHRH, expressed in the arcuate nucleus of the hypothalamus and released into portal vasculature, directly stimulates growth hormone synthesis and secretion from the pituitary somatotropes by activating the corresponding GHRH receptors[1]. | ||||||
| Name | Human growth hormone-releasing factor TFA | ||||||
| Shortening | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 | ||||||
| Formula | C217H359F3N72O68S | ||||||
| Molar Mass | 5153.67 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Human growth hormone-releasing factor TFA
CAS: F: C217H359F3N72O68S W: 5153.67
Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.