| Bioactivity | Heteropodatoxin-1 (HpTx1), a spider peptide toxin, is a Kv4.2 current inhibitor. Heteropodatoxin-1 also inhibits Nav1.7 and activates Nav1.9 but does not affect Nav1.8[1]. |
| Name | Heteropodatoxin-1 |
| Sequence | Asp-Cys-Gly-Thr-Ile-Trp-His-Tyr-Cys-Gly-Thr-Asp-Gln-Ser-Glu-Cys-Cys-Glu-Gly-Trp-Lys-Cys-Ser-Arg-Gln-Leu-Cys-Lys-Tyr-Val-Ile-Asp-Trp-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys27) |
| Shortening | DCGTIWHYCGTDQSECCEGWKCSRQLCKYVIDW-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys27) |
| Formula | C168H238N46O51S6 |
| Molar Mass | 3910.35 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Xi Zhou, et al. Spider venom-derived peptide induces hyperalgesia in Nav1.7 knockout mice by activating Nav1.9 channels. Nat Commun. 2020 May 8;11(1):2293. |
Heteropodatoxin-1
CAS: F: C168H238N46O51S6 W: 3910.35
Heteropodatoxin-1 (HpTx1), a spider peptide toxin, is a Kv4.2 current inhibitor. Heteropodatoxin-1 also inhibits Nav1.7
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.