PeptideDB

Hainantoxin-III

CAS: 1809149-40-3 F: C154H228N44O45S6 W: 3608.12

Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM.
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively[1].
Name Hainantoxin-III
CAS 1809149-40-3
Sequence Gly-Cys-Lys-Gly-Phe-Gly-Asp-Ser-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Val-Tyr-Leu-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
Shortening GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
Formula C154H228N44O45S6
Molar Mass 3608.12
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Yucheng Xiao, et al. Inhibition of neuronal tetrodotoxin-sensitive Na+ channels by twospider toxins: hainantoxin-III and hainantoxin-IV. Eur J Pharmacol. 2003 Sep 5;477(1):1-7. [2]. Yunxiao Zhang, et al. Engineering of highly potent and selective HNTX-III mutant against hNav1.7 sodium channel for treatment of pain. J Biol Chem. 2021 Jan-Jun:296:100326.