| Bioactivity | Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively[1]. |
| Name | Hainantoxin-III |
| CAS | 1809149-40-3 |
| Sequence | Gly-Cys-Lys-Gly-Phe-Gly-Asp-Ser-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Val-Tyr-Leu-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
| Shortening | GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
| Formula | C154H228N44O45S6 |
| Molar Mass | 3608.12 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yucheng Xiao, et al. Inhibition of neuronal tetrodotoxin-sensitive Na+ channels by twospider toxins: hainantoxin-III and hainantoxin-IV. Eur J Pharmacol. 2003 Sep 5;477(1):1-7. [2]. Yunxiao Zhang, et al. Engineering of highly potent and selective HNTX-III mutant against hNav1.7 sodium channel for treatment of pain. J Biol Chem. 2021 Jan-Jun:296:100326. |