PeptideDB

Gastrin-Releasing Peptide, human

CAS: 93755-85-2 F: C130H204N38O31S2 W: 2859.38

Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
Invitro Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. However, GRP/bombesin-like immunoreactivity is widely distributed in mammalian brain, especially the hypothalamus, GI tract and in human fetal lung[1].
Name Gastrin-Releasing Peptide, human
CAS 93755-85-2
Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Shortening VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Formula C130H204N38O31S2
Molar Mass 2859.38
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)