| Bioactivity | Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. | ||||||
| Invitro | Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. However, GRP/bombesin-like immunoreactivity is widely distributed in mammalian brain, especially the hypothalamus, GI tract and in human fetal lung[1]. | ||||||
| Name | Gastrin-Releasing Peptide, human | ||||||
| CAS | 93755-85-2 | ||||||
| Sequence | Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 | ||||||
| Shortening | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 | ||||||
| Formula | C130H204N38O31S2 | ||||||
| Molar Mass | 2859.38 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Gastrin-Releasing Peptide, human
CAS: 93755-85-2 F: C130H204N38O31S2 W: 2859.38
Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.