PeptideDB

GLP-2(1-33)(human)

CAS: 223460-79-5 F: C165H254N44O55S W: 3766.19

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intes
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
Invitro GLP-2-treated group demonstrates a 518±22% increase (Pin vitro model of the entire intestine. FRIC cultures have previously been established to express a functional GLP-2 receptor (GLP-2R) that displays a cAMP response, as well as enhances IGF-1 mRNA expression and IGF-1 secretion in response to GLP-2 treatment. When incubates with GLP-2 (10−8 M) for 2 hours, IGFBP-4 mRNA expression in the FRIC cultures is also found to be increased, by 40.8±15.2% (P<0.05), compare with vehicle-treated cells[1].
Name GLP-2(1-33)(human)
CAS 223460-79-5
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Formula C165H254N44O55S
Molar Mass 3766.19
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)