| Bioactivity | GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) TFA is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) TFA can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1]. |
| Name | GLP-1 (1-36) amide (human, rat) (TFA) |
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (TFA salt) |
| Shortening | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (TFA salt) |
| Formula | C184H273N51O57.xC2HF3O2 |
| Molar Mass | 4111.44 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Schmidtler J, Schepp W, Janczewska I, et al. GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am J Physiol. 1991;260(6 Pt 1):G940-G950. |
GLP-1 (1-36) amide (human, rat) (TFA)
CAS: F: C184H273N51O57.xC2HF3O2 W: 4111.44 (free base)
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) TFA is a molecular variant of glucag
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.