| Bioactivity | GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor[1][2]. | ||||||
| Invitro | GLP-1(9-36)amide potently inhibits hepatic glucose production (HGP) and is a weak insulinotropic agent[2]. | ||||||
| Name | GLP-1(9-36)amide | ||||||
| CAS | 161748-29-4 | ||||||
| Sequence | Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 | ||||||
| Shortening | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | ||||||
| Formula | C140H214N36O43 | ||||||
| Molar Mass | 3089.41 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Knudsen LB, et al. Glucagon-like peptide-1-(9-36) amide is a major metabolite of glucagon-like peptide-1-(7-36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor. Eur J Pharmacol. 1996;318(2-3):429-435. [2]. Elahi D, et al. GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide. Obesity (Silver Spring). 2008;16(7):1501-1509. |
GLP-1(9-36)amide
CAS: 161748-29-4 F: C140H214N36O43 W: 3089.41
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.