| Bioactivity | GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. |
| Invitro | The sequence of Glucagon-Like Peptide after residue 7 shows similarities to glucagon and to other biologically active members of the secretin peptide family, particularly glucose-dependent insulinotropic peptide (GIP). This sequence has been especially well preserved, showing 66% nucleotide homology with GLP-1 in the proglucagon of the very primitive anglerfish. This 7-36 sequence of GLP-1 is a potent insulin-releasing peptide in vitro[1]. Glucagon-Like Peptide (GLP) I (7-36), amide is a product of the tissue-specific post-translational processing of the glucagon precursor. It is released postprandially from intestinal endocrine L cells and stimulates insulin secretion. DPP IV is the main degradation enzyme for GLP-l(7 - 36)amide in human serum. Dipeptidyl-peptidase IV can initiate the metabolism of GIP and GLP-1(7-36)amide in human serum[2]. |
| Name | GLP-1(7-36), amide |
| CAS | 107444-51-9 |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Formula | C149H226N40O45 |
| Molar Mass | 3297.68 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |