| Bioactivity | GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. | ||||||
| Invitro | Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE[1]. | ||||||
| Name | GLP-1(7-36), amide acetate | ||||||
| CAS | 1119517-19-9 | ||||||
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 | ||||||
| Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2 | ||||||
| Formula | C149H226N40O45.xC2H4O2 | ||||||
| Molar Mass | 3357.73 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |