| Bioactivity | GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo[1]. | ||||||
| Invitro | The incretin hormone GIP is rapidly degraded in the circulation by dipeptidyl peptidase IV (DPP IV) forming the N-terminally truncated peptide GIP(3-42)[1]. | ||||||
| Name | GIP (3-42), human | ||||||
| CAS | 1802086-25-4 | ||||||
| Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln | ||||||
| Shortening | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | ||||||
| Formula | C214H324N58O63S | ||||||
| Molar Mass | 4749.40 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
||||||
| Reference | [1]. V A Gault, et al. Evidence that the major degradation product of glucose-dependent insulinotropic polypeptide, GIP(3-42), is a GIP receptor antagonist in vivo. J Endocrinol. 2002 Nov;175(2):525-33. |
GIP (3-42), human
CAS: 1802086-25-4 F: C214H324N58O63S W: 4749.40
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insul
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.