| Bioactivity | GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion[1][2][3]. | ||||||
| Invitro | Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity. | ||||||
| Name | GIP, human | ||||||
| CAS | 100040-31-1 | ||||||
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln | ||||||
| Shortening | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | ||||||
| Formula | C226H338N60O66S | ||||||
| Molar Mass | 4983.60 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
GIP, human
CAS: 100040-31-1 F: C226H338N60O66S W: 4983.60
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.