| Bioactivity | Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negative bacteria and tumor cells. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in the study of microbial infections and cancer[1]. |
| Name | Crotalicidin |
| CAS | 1818372-26-7 |
| Sequence | Lys-Arg-Phe-Lys-Lys-Phe-Phe-Lys-Lys-Val-Lys-Lys-Ser-Val-Lys-Lys-Arg-Leu-Lys-Lys-Ile-Phe-Lys-Lys-Pro-Met-Val-Ile-Gly-Val-Thr-Ile-Pro-Phe-NH2 |
| Shortening | KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF-NH2 |
| Formula | C203H346N54O36S |
| Molar Mass | 4151.32 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Falcao CB, et al. Structural Dissection of Crotalicidin, a Rattlesnake Venom Cathelicidin, Retrieves a Fragment with Antimicrobial and Antitumor Activity. J Med Chem. 2015 Nov 12;58(21):8553-63. |
Crotalicidin
CAS: 1818372-26-7 F: C203H346N54O36S W: 4151.32
Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negati
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.