PeptideDB

Crotalicidin

CAS: 1818372-26-7 F: C203H346N54O36S W: 4151.32

Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negati
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negative bacteria and tumor cells. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in the study of microbial infections and cancer[1].
Name Crotalicidin
CAS 1818372-26-7
Sequence Lys-Arg-Phe-Lys-Lys-Phe-Phe-Lys-Lys-Val-Lys-Lys-Ser-Val-Lys-Lys-Arg-Leu-Lys-Lys-Ile-Phe-Lys-Lys-Pro-Met-Val-Ile-Gly-Val-Thr-Ile-Pro-Phe-NH2
Shortening KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF-NH2
Formula C203H346N54O36S
Molar Mass 4151.32
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Falcao CB, et al. Structural Dissection of Crotalicidin, a Rattlesnake Venom Cathelicidin, Retrieves a Fragment with Antimicrobial and Antitumor Activity. J Med Chem. 2015 Nov 12;58(21):8553-63.