PeptideDB

Citrullinated amyloid-β (1-40) peptide (human)

CAS: F: C194H294N52O59S W: 4330.79

Citrullinated amyloid-β (1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) (HY-P
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Citrullinated amyloid-β (1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) (HY-P0265) with a citrullination at the Arg5 site. Citrullinated amyloid-β (1-40) peptide (human) exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of distorted parallel β-sheets compared with unmodified β-Amyloid (1-40)[1].
Name Citrullinated amyloid-β (1-40) peptide (human)
Sequence Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Shortening DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Formula C194H294N52O59S
Molar Mass 4330.79
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Osaki D, Hiramatsu H. Citrullination and deamidation affect aggregation properties of amyloid β-proteins. Amyloid. 2016 Dec;23(4):234-241.