| Bioactivity | Citrullinated amyloid-β (1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) (HY-P0265) with a citrullination at the Arg5 site. Citrullinated amyloid-β (1-40) peptide (human) exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of distorted parallel β-sheets compared with unmodified β-Amyloid (1-40)[1]. |
| Name | Citrullinated amyloid-β (1-40) peptide (human) |
| Sequence | Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Shortening | DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Formula | C194H294N52O59S |
| Molar Mass | 4330.79 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Osaki D, Hiramatsu H. Citrullination and deamidation affect aggregation properties of amyloid β-proteins. Amyloid. 2016 Dec;23(4):234-241. |