PeptideDB

Calmodulin Binding Peptide 1

CAS: 104041-80-7 F: C231H373N69O70S2 W: 5301.10

Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain k
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca2+ release [1].
Name Calmodulin Binding Peptide 1
CAS 104041-80-7
Sequence Gly-Val-Met-Pro-Arg-Glu-Glu-Thr-Asp-Ser-Lys-Thr-Ala-Ser-Pro-Trp-Lys-Ser-Ala-Arg-Leu-Met-Val-His-Thr-Val-Ala-Thr-Phe-Asn-Ser-Ile-Lys-Glu-Leu-Asn-Glu-Arg-Trp-Arg-Ser-Leu-Gln-Gln-Leu-Ala
Shortening GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA
Formula C231H373N69O70S2
Molar Mass 5301.10
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. González-Andrade M, et al. Importance of the interaction protein-protein of the CaM-PDE1A and CaM-MLCK complexes in the development of new anti-CaM drugs. J Mol Recognit. 2013 Apr;26(4):165-74.