| Bioactivity | Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research[1][2][3]. | ||||||
| Invitro | Calcitonin shows a potent inhibitory action on osteoclast mediated bone resorption[1]. | ||||||
| Name | Calcitonin (human) | ||||||
| CAS | 21215-62-3 | ||||||
| Sequence | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7) | ||||||
| Shortening | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge:Cys1-Cys7) | ||||||
| Formula | C151H226N40O45S3 | ||||||
| Molar Mass | 3417.87 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Calcitonin (human)
CAS: 21215-62-3 F: C151H226N40O45S3 W: 3417.87
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Cal
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.