| Bioactivity | CRAMP (mouse) is an antimicrobial peptide. CRAMP (mouse) can be used for the research of biofilm-associated infections[1]. |
| Name | CRAMP (mouse) |
| CAS | 376364-36-2 |
| Sequence | Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
| Shortening | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Formula | C178H302N50O46 |
| Molar Mass | 3878.61 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. De Brucker K, et al. Derivatives of the mouse cathelicidin-related antimicrobial peptide (CRAMP) inhibit fungal and bacterial biofilm formation. Antimicrob Agents Chemother. 2014 Sep;58(9):5395-404. |
CRAMP (mouse)
CAS: 376364-36-2 F: C178H302N50O46 W: 3878.61
CRAMP (mouse) is an antimicrobial peptide. CRAMP (mouse) can be used for the research of biofilm-associated infections.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.