| Bioactivity | C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal fibroblasts by generating the second messenger cGMP[1]. |
| CAS | 129405-72-7 |
| Sequence | Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn-Lys-Lys-Gly-Leu- Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfidebridge:Cys37-Cys53) |
| Shortening | DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC (Disulfidebridge:Cys37-Cys53) |
| Formula | C251H414N82O70S3 |
| Molar Mass | 5796.68 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Chen Y, et al. C53: A novel particulate guanylyl cyclase B receptor activator that has sustained activity in vivo with anti-fibrotic actions in human cardiac and renal fibroblasts. J Mol Cell Cardiol. 2019 May;130:140-150. |
C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse
CAS: 129405-72-7 F: C251H414N82O70S3 W: 5796.68
C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.