| Bioactivity | Albiglutide TFA, a glucagon-like peptide (GLP)-1 mimetic, is a long acting GLP-1 receptor agonist. Albiglutide TFA significantly reduces glycosylated hemoglobin (A1C). Albiglutide TFA can be used for type 2 diabetes (T2D) research. Albiglutide TFA is generated by the genetic fusion of a DPP-4-resistant GLP-1 dimer to human albumin[1][2][3]. | ||||||
| Name | Albiglutide TFA | ||||||
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 | ||||||
| Shortening | HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | ||||||
| Formula | C150H225F3N40O47 | ||||||
| Molar Mass | 3397.63 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Albiglutide TFA
CAS: F: C150H225F3N40O47 W: 3397.63
Albiglutide TFA, a glucagon-like peptide (GLP)-1 mimetic, is a long acting GLP-1 receptor agonist. Albiglutide TFA signi
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.