Bioactivity | Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MCR4) to increase food intake[1][2]. |
Name | Agouti-related Protein (AGRP) (83-132) Amide (human) |
Shortening | SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8) |
Formula | C235H362N76O67S11 |
Molar Mass | 5676.60 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |