| Bioactivity | Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake[1][2]. | ||||||
| Target | Melanocortin-4 receptor | ||||||
| In Vivo | Agouti-related Protein (AGRP) (83-132) increases food intake and decreases spontaneous locomotor activity in rats[2]. | ||||||
| Name | Agouti-related Protein (AGRP) (83-132) Amide (human) (TFA) | ||||||
| Sequence | Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8) | ||||||
| Shortening | SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8) | ||||||
| Formula | C235H362N76O67S11.C2HF3O2 | ||||||
| Molar Mass | 5790.62 | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
||||||
| Reference | [1]. Donald W. Pfaff, et al. Chapter 1 - Hormones Can Facilitate or Suppress Behaviors. Principles of Hormone/Behavior Relations (Second Edition). Academic Press, 2018, Pages 3-26, ISBN 9780128113714. [2]. Tang-Christensen M, et al. Central administration of ghrelin and agouti-related protein (83-132) increases food intake and decreases spontaneous locomotor activity in rats. Endocrinology. 2004 Oct;145(10):4645-52. |
Agouti-related Protein (AGRP) (83-132) Amide (human) (TFA)
CAS: F: C235H362N76O67S11.C2HF3O2 W: 5790.62
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a prote
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.