PeptideDB

Aeschna defensin

CAS: F: C173H267N55O52S7 W: 4173.76

Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria[1].
Name Aeschna defensin
Sequence Gly-Phe-Gly-Cys-Pro-Leu-Asp-Gln-Met-Gln-Cys-His-Arg-His-Cys-Gln-Thr-Ile-Thr-Gly-Arg-Ser-Gly-Gly-Tyr-Cys-Ser-Gly-Pro-Leu-Lys-Leu-Thr-Cys-Thr-Cys-Tyr-Arg (Disulfide bridge:C4-C26; C11-C34; C15-C36 )
Shortening GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR (Disulfide bridge:C4-C26; C11-C34; C15-C36 )
Formula C173H267N55O52S7
Molar Mass 4173.76
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Bulet P, et al. A novel insect defensin mediates the inducible antibacterial activity in larvae of the dragonfly Aeschna cyanea (Paleoptera, Odonata). Eur J Biochem. 1992 Nov 1;209(3):977-84.