| Bioactivity | Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria[1]. |
| Name | Aeschna defensin |
| Sequence | Gly-Phe-Gly-Cys-Pro-Leu-Asp-Gln-Met-Gln-Cys-His-Arg-His-Cys-Gln-Thr-Ile-Thr-Gly-Arg-Ser-Gly-Gly-Tyr-Cys-Ser-Gly-Pro-Leu-Lys-Leu-Thr-Cys-Thr-Cys-Tyr-Arg (Disulfide bridge:C4-C26; C11-C34; C15-C36 ) |
| Shortening | GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR (Disulfide bridge:C4-C26; C11-C34; C15-C36 ) |
| Formula | C173H267N55O52S7 |
| Molar Mass | 4173.76 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bulet P, et al. A novel insect defensin mediates the inducible antibacterial activity in larvae of the dragonfly Aeschna cyanea (Paleoptera, Odonata). Eur J Biochem. 1992 Nov 1;209(3):977-84. |
Aeschna defensin
CAS: F: C173H267N55O52S7 W: 4173.76
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.