PeptideDB

ATX-II

CAS: 60748-45-0 F: C213H323N63O61S6 W: 4934.62

ATX-II is a specific Na+ channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata).
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity ATX-II is a specific Na+ channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na+
Name ATX-II
CAS 60748-45-0
Sequence Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Ile-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Lys-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bonds: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45)
Shortening GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ (Disulfide bonds: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45)
Formula C213H323N63O61S6
Molar Mass 4934.62
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Fletcher JE, et al. ATX II, a sodium channel toxin, sensitizes skeletal muscle to halothane, caffeine, and ryanodine. Anesthesiology. 1999 May;90(5):1294-301. [2]. Lu YY, et al. ATX-II-induced pulmonary vein arrhythmogenesis related to atrial fibrillation and long QT syndrome. Eur J Clin Invest. 2012 Aug;42(8):823-31.