| Bioactivity | (Pyr3)-Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits[1]. |
| Name | (Pyr3)-Amyloid β-Protein (3-42) (TFA) |
| Sequence | {Pyr}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Shortening | {Pyr}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Formula | C196H299N53O55S.xC2HF3O2 |
| Molar Mass | 4309.86 (free acid) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Takahashi-Ito K, et.al. Memantine inhibits β-amyloid aggregation and disassembles preformed β-amyloid aggregates. Biochem Biophys Res Commun. 2017 Nov 4;493(1):158-163. |