| Bioactivity | (Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the research of Alzheimer's disease[1]. |
| Name | (Pyr11)-Amyloid β-Protein (11-40) |
| CAS | 192377-94-9 |
| Sequence | {Pyr}-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Shortening | {Pyr}-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Formula | C143H226N38O39S |
| Molar Mass | 3133.62 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. He W, et al. The A beta 3-pyroglutamyl and 11-pyroglutamyl peptides found in senile plaque have greater beta-sheet forming and aggregation propensities in vitro than full-length A beta. Biochemistry. 1999 Aug 17;38(33):10871-7. |
(Pyr11)-Amyloid β-Protein (11-40)
CAS: 192377-94-9 F: C143H226N38O39S W: 3133.62
(Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.