PeptideDB

(Pyr11)-Amyloid β-Protein (11-40)

CAS: 192377-94-9 F: C143H226N38O39S W: 3133.62

(Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity (Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the research of Alzheimer's disease[1].
Name (Pyr11)-Amyloid β-Protein (11-40)
CAS 192377-94-9
Sequence {Pyr}-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Shortening {Pyr}-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Formula C143H226N38O39S
Molar Mass 3133.62
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. He W, et al. The A beta 3-pyroglutamyl and 11-pyroglutamyl peptides found in senile plaque have greater beta-sheet forming and aggregation propensities in vitro than full-length A beta. Biochemistry. 1999 Aug 17;38(33):10871-7.