| Bioactivity | (Lys22)-Amyloid β-Protein (1-42) is a mutation of WT Amyloid β-Protein (1-42) peptide[1]. |
| Name | (Lys22)-Amyloid β-Protein (1-42) |
| CAS | 383200-59-7 |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Shortening | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA |
| Formula | C204H316N56O58S |
| Molar Mass | 4513.10 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. David Lowe, et al. Transgenic flies expressing Abeta42-Italian. US20050132425A1. |