| CAS | 125093-93-8 |
| Sequence | H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
| Sequence Single | KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Molecular Formula | C154H257N49O40S |
| Molecular Weight | 3467.11 |
| Synonyms | [Lys1, Pro2,5, Arg3,4, Tyr6] VIP, human, porcine, rat, ovine |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cancer Research |
| Description | VIP Antagonist also called [Lys1, Pro2,5, Arg3,4, Tyr6] VIP, human, porcine, rat, ovine, a hybrid of neurotensin (6-11) and VIP (7-28), is a competitive antagonist of VIP-binding to glial cells. In rats with reduced masculine potential, The peptide markedly inhibits VIP-stimulated sexual behaviour. Furthermore, it has been shown to antagonize VIP receptors on non-small cell lung cancer cells, thereby inhibiting tumor growth in vitro and in vivo. |
| References | 1. The block of central vasopressin V1 but not V2 receptors suppresses grooming behavior and hypothermia induced by intracerebroventricular vasopressin in male rats. F.Drago et al., Peptides, 18, 1389 (1997) 2. A vasoactive intestinal peptide antagonist inhibits non-small cell lung cancer growth. T.W.Moody et al., Proc. Natl. Acad. Sci. USA, 90, 4345 (1993) |