| CAS | 12583-68-5 |
| Sequence | H-Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence Single | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
| Molecular Formula | C183H288N54O50S2 |
| Molecular Weight | 4108.77 |
| Synonyms | Parathyroid Hormone (1-34), bovine |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research |
| Description | pTH (1-34) (bovine) also called Parathyroid Hormone (1-34), bovine, is a potent parathyroid hormone (PTH) receptor agonist. pTH (1-34) (bovine) increases calcium and inorganic phosphate levels in vivo. pTH (1-34) (bovine) can be used for th reseach of osteoporosis. |
| References | 1. Molecular and cellular mechanisms of the anabolic effect of intermittent PTH. R.L.Jilka, Bone, 40, 1434 (2007) 2. Effects of synthetic parathyroid hormone on hemodynamics and regional blood flows. H.-H.Wang et al., Eur. J. Pharmacol., 97, 209 (1984) 3. Proton NMR studies of the biologically active 1-34 fragment of bovine parathyroid hormone: examination of a structural model. L.M.Smith et al., Arch. Biochem. Biophys., 253, 81 (1987) 4. Comparative study on the cardiac actions of bovine parathyroid hormone (1-34). J.S.K.Sham et al., Gen. Comp. Endocrinol., 61, 148 (1986) 5. Acute hypotensive action of parathyroid hormone-(1--34) fragments in hypertensive rats. R.Nakamura et al., Proc. Soc. Exp. Biol. Med., 168, 168 (1981) 6. Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. B H Mitlak, et al. J Bone Miner Res. 1992 May;7(5):479-84. 7. Studies on chondrocytes from mandibular condylar cartilage, nasal septal cartilage, and spheno-occipital synchondrosis in culture. I. Morphology, growth, glycosaminoglycan synthesis, and responsiveness to bovine parathyroid hormone (1-3). M Takigawa, et al. |