| CAS | 173833-08-4 |
| Sequence | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH2 |
| Sequence Single | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-NH2 |
| Molecular Formula | C162H270N50O46S2 |
| Molecular Weight | 3718.37 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research |
| Description | pTH (1-31) amide (human) appears so far to be the smallest of the potently osteogenic pTH fragments. The osteogenic activity of pTH (1-31) amide (human) seems to be related to its ability to activate adenylyl cyclase. Unlike pTH, this fragment does not activate phospholipase C and should therefore have fewer side-effects and find application in the osteoporosis treatment. |
| References | 1. Derivatization of carboxylic acids by reaction with 4’-bromophenacyl methanesulfonate prior to determination by high-performance liquid chromatography. S.T.Ingalls et al., J. Chromatogr., 299, 365 (1984) |