PeptideDB

Psalmotoxin 1

CAS No.: 316808-68-1

Psalmotoxin 1 also called PcTx1, is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM).
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 316808-68-1
Sequence H-Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr-OH(Modifications: Disulfide bridges: 3-18, 10-23, 17-33)
Sequence Single EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Modifications: Disulfide bridges: 3-18, 10-23, 17-33)
Molecular Formula C200H312N62O57S6
Molecular Weight 4689.41
Synonyms PcTx1
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Description Psalmotoxin 1 also called PcTx1, is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM). Psalmotoxin 1 displays no effect at ASIC1b, ASIC2a, ASIC3, heteromeric ASIC channels, ENaC and KV2.1/2.2/4.2/4.3 channels expressed in oocytes, at concentrations up to 100 nM. Psalmotoxin 1 displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents.
References 1.  A tarantula peptide against pain via ASIC1a channels and opioid mechanisms. Mazzuca et al (2007). Nat.Neurosci. 10 943 PMID: 17632507 2.  Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. Escoubas et al (2000). J.Biol.Chem. 275 25116 PMID: 10829030 3.  Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Escoubas et al (2003). Protein Sci. 12 1332 PMID: 12824480 4.  The receptor site of the spider toxin PcTx1 on the proton-gated cation channel ASIC1a. Salinas et al (2006). J.Physiol. 570 339 PMID: 16284080