| CAS | 151126-32-8 |
| Sequence | H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2(Disulfide bridge: 2-7) |
| Sequence Single | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2(Disulfide bridge: 2-7) |
| Molecular Formula | C171H267N51O53S2 |
| Molecular Weight | 3949.42 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Pramlintide is a synthetic version of amylin. Pramlintide exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Pramlintide can reduce postprandial hyperglycemia; Pramlintide also inhibits gastric emptying. |
| References | 1. Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Hoogwerf et al (2008). Vasc. Health Risk Manag. 4 355 PMID: 18561511 2. Preclinical pharmacology of pramli. in the rat: comparisons with human and rat amylin. Young et al (1996). Drug Dev.Res. 37 231 |