| CAS | 122071-54-9 |
| Sequence | H-Leu-Ser-Asp-Asp-Met-Pro-Ala-Thr-Pro-Ala-Asp-Gln-Glu-Met-Tyr-Arg-Gln-Asp-Pro-Glu-Gln-Ile-Asp-Ser-Arg-Thr-Lys-Tyr-Phe-Ser-Pro-Arg-Leu-NH2 |
| Sequence Single | LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL-NH2 |
| Molecular Formula | C167H259N47O57S2 |
| Molecular Weight | 3901.31 |
| Synonyms | HeA-PBAN, HeZ-PBAN |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) also called HeA-PBAN, HeZ-PBAN, is a pheromone biosynthesis activating neuropeptide hormone which in the picomolar range induced sex pheromone synthesis in various moth species. |
| References | 1. H3 relaxin demonstrates antifibrotic properties via the RXFP1 receptor. M.A.Hossain et al., Biochemistry, 50, 1368 (2011) |
Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea)
CAS No.: 122071-54-9
Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) also called HeA-PBAN, HeZ-PBAN, is a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.