| CAS | 118997-30-1 |
| Sequence | H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Single | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Molecular Formula | C194H295N55O57 |
| Molecular Weight | 4309.81 |
| Synonyms | PYY (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Gastrointestinal Research |
| Description | Peptide YY (human) also called PYY (human), is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (human) can mediate its effects through the Neuropeptide Y receptors. |
| References | 1. Biologically active synthetic peptides as probes of embryonic development: a competitive peptide inhibitor of fibronectin function inhibits gastrulation in amphibian embryos and neural crest cell migration in avian embryos. J.-C.Boucaut et al., J. Cell Biol., 99, 1822 (1984) 2. The gut hormone peptide YY regulates appetite. Peptide YY, et al. Ann N Y Acad Sci. 2003 Jun;994:162-8. 3. Isolation and characterization of peptide YY (PYY ), a candidate gut hormone that inhibits pancreatic exocrine secretion. Tatemoto K, et al. Proc Natl Acad Sci U S A. 1982 Apr;79(8):2514-8. 4. Role of Peptide YY in blood vessel function and atherosclerosis in a rabbit model. Smith RM, et al. Clin Exp Pharmacol Physiol. 2015 Jun;42(6):648-52. |