| CAS | 62340-29-8 |
| Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Sequence Single | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Molecular Formula | C192H295N59O60S |
| Molecular Weight | 4421.86 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Oxyntomodulin (porcine, bovine) is a endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Oxyntomodulin (porcine, bovine) is also secreted by intestinal L-cells. Oxyntomodulin (porcine, bovine) increases cAMP production and inhibits gastric acid secretion in rat stomach. Oxyntomodulin (porcine, bovine) is also a weak glucagon receptor agonist. |
| References | 1. Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Bataille et al (1981). Peptides 2 41 PMID: 6283496 2. A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine. Stumpel et al (1997). FEBS Lett. 410 515 PMID: 9237694 3. Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion. Jarrousse et al (1985). FEBS Lett. 188 81 PMID: 4018272 4. Preproglucagon derived peptides GLP-1, GLP-2 and oxyntomodulin in the CNS: role of peripherally secreted and centrally produced peptides. Vrang and Larsen et al (2010). Prog.Neurobiol. 92 442 PMID: 20638440 |
Oxyntomodulin (porcine, bovine)
CAS No.: 62340-29-8
Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Oxyntomodulin (porcine, bovine) is a endogenous preprogluca
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.