| CAS | 159002-68-3 |
| Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH |
| Sequence Single | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
| Molecular Formula | C192H295N61O60S |
| Molecular Weight | 4449.9 |
| Synonyms | Glucagon-37 (human, mouse, rat), OXM (human, mouse, rat), Preproglucagon (53-89) (human, mouse, rat), Proglucagon (33-69) (human, mouse, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes|Veterinary Medicine |
| Description | Oxyntomodulin (human, mouse, rat) also called Glucagon-37 (human, mouse, rat), OXM (human, mouse, rat), Preproglucagon (53-89) (human, mouse, rat), Proglucagon (33-69) (human, mouse, rat), potently inhibits gastric acid secretion and pancreatic enzyme secretion when infused iv. Moreover, it was shown that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner. |
| References | 1. Highly potent cyclic disulfide antagonists of somatostatin. S.J.Hocart et al., J. Med. Chem., 42, 1863 (1999) 2. Co-administration of SR141716 with peptide YY3-36 or oxyntomodulin has additive effects on food intake in mice. N.E.White et al., Diabetes Obes. Metab., 10, 167 (2008) |
Oxyntomodulin (human, mouse, rat)
CAS No.: 159002-68-3
Oxyntomodulin (human, mouse, rat) also called Glucagon-37 (human, mouse, rat), OXM (human, mouse, rat), Preproglucagon (
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.