Neuropeptide Y (3-36) (human, rat) Neuropeptide Y Catalog

CAS	150138-78-6
Sequence	H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence Single	SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Molecular Formula	C175H269N53O54S
Molecular Weight	4011.45
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Obesity Research
Description	Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor.
References	1. Proteases involved in the metabolism of angiotensin II, bradykinin, calcitonin gene-related peptide (CGRP), and neuropeptide Y by vascular smooth muscle cells. R.Mentlein and T.Roos, Peptides, 17, 709 (1996) 2. Neuropeptide Y 3-36 is an endogenous ligand selective for Y2 receptors. D.Grandt et al., Regul. Pept., 67, 33 (1996) 3. DPP (Dipeptidyl Peptidase)-4 Inhibition Potentiates the Vasoconstrictor Response to NPY (Neuropeptide Y) in Humans During Renin-Angiotensin-Aldosterone System Inhibition. Hubers SA, et al. Hypertension. 2018;72(3):712-719.

PeptideDB