| CAS | 1872441-22-9 |
| Sequence | H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH |
| Sequence Single | YDEYLKQVIEVLETDPHFREKLQKADIEEI |
| Molecular Formula | C167H260N40O54 |
| Molecular Weight | 3692.14 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Obesity Research|Pituitary & Hypothalamic Hormones |
| Description | Nesfatin-1 (30-59) (mouse, rat) is the active core fragment of full length 82-mer nesfatin-1 with the seuqence of YDEYLKQVIEVLETDPHFREKLQKADIEEI. Nesfatin-1 (30-59) (mouse, rat) induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment. |
Nesfatin-1 (30-59) (mouse, rat)
CAS No.: 1872441-22-9
Nesfatin-1 (30-59) (mouse, rat) is the active core fragment of full length 82-mer nesfatin-1 with the seuqence of YDEYLK
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.