| CAS | 201995-58-6 |
| Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2 |
| Sequence Single | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 |
| Molecular Formula | C142H240N44O38 |
| Molecular Weight | 3171.74 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) is a high affinity selective agonist for the human and rat VPAC1 receptors. The compound exhibited negligible affinity for the PACAP and secretin receptors. |
(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27)
CAS No.: 201995-58-6
(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) is a high affinity selective agonist for the human and rat VPAC1 receptors. The
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.