| CAS | 87805-34-3 |
| Sequence | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Sequence Single | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Molecular Formula | C186H275N51O59 |
| Molecular Weight | 4169.54 |
| Synonyms | Glucagon-Like Peptide 1 (1-37) (human, bovine, guinea pig, mouse, rat), Proglucagon (72-108) (human, bovine, guinea pig, mouse, rat), Preproglucagon (92-128) (human, bovine, guinea pig, mouse, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) also called Glucagon-like peptide 1 (1-37) is a highly potent agonist of the GLP-1 receptor. Glucagon-Like Peptide 1 (GLP-1) is synthesized by posttranslational processing of proglucagon in the intestine and pancreas and plays an important role in metabolic homeostasis. Among the different molecular forms, such as GLP-1 (7-36) amide and GLP-1 (7-37), the function of GLP-1 (1-37) has been unclear. GLP-1 (1-37) was shown to convert intestinal epithelial cells into insulin-producing cells. These observations turned GLP-1 (1-37) into a new promising therapeutic compound for the treatment of diabetes mellitus. In animal models of dilated cardiomyopathy, hypertensive heart failure, and myocardial infarction, GLP-1 has shown a remarkable cardioprotective activity. |
| References | 1. Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor. S.Y.Hsu and A.J.Hsueh, Nat. Med., 7, 605 (2001) 2. Glucagon like peptide-1 is protective against myocardial ischemia/reperfusion injury when given either as a preconditioning mimetic or at reperfusion in an isolated rat heart model. A.K.Bose et al., Cardiovasc. Drugs Ther., 19, 9 (2005) 3. Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into insulin-producing cells. A.Suzuki et al., Proc. Natl. Acad. Sci. USA, 100, 5034 (2003) 4. Emerging cardiovascular actions of the incretin hormone glucagon-like peptide-1: potential therapeutic benefits beyond glycaemic control? D.J.Grieve et al., Br. J. Pharmacol., 157, 1340 (2009) |
GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS No.: 87805-34-3
GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) also called Glucagon-like peptide 1 (1-37) is a highly potent agoni
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.